Pfam domain
Pfam family: PHP (PF02811.21)
Uniprot AC: P10443
RecName: DNA polymerase III subunit alpha
Begin-End: 8-173
Organism: Escherichia coli
Interaction Mode:   

Sequence:
HLRVHSDYSMIDGLAKTAPLVKKAAALGMPALAITDFTNLCGLVKFYGAGHGAGIKPIVG
ADFNVQCDLLGDELTHLTVLAANNTGYQNLTLLISKAYQRGYGAAGPIIDRDWLIELNEG
LILLSGGRMGDVGRSLLRGNSALVDECVAFYEEHFPDRYFLELIRT
Structures of the domain P10443 8-173
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5fkw X-ray 7.3 A 8-173 None
5m1s X-ray 6.7 A 8-173 None
5fkv X-ray 8 A 8-173 None


© NPIDB team 2003 - 2021

text