Pfam domain
Pfam family: tRNA_anti-codon (PF01336.27)
Uniprot AC: P10443
RecName: DNA polymerase III subunit alpha
Begin-End: 994-1073
Organism: Escherichia coli
Interaction Mode:   

Sequence:
ITAAGLVVAARVMVTKRGNRIGICTLDDRSGRLEVMLFTDALDKYQQLLEKDRILIVSGQ
VSFDDFSGGLKMTAREVMDI
Structures of the domain P10443 994-1073
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5fkv X-ray 8 A 994-1073  S-Bb 


© NPIDB team 2003 - 2021

text