Pfam domain
Pfam family: zf-C4 (PF00105.17)
Uniprot AC: P10826
RecName: Retinoic acid receptor beta
Begin-End: 87-155
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
PCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQ
KCFEVGMSK
Structures of the domain P10826 87-155
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5uan X-ray 3.51 B 81-148  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2019

text