Pfam domain
Pfam family: RNA_pol_Rpb1_3 (PF04983.17)
Uniprot AC: P10964
RecName: DNA-directed RNA polymerase I subunit RPA190
Begin-End: 656-833
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
QYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHTTRSKIVTL
PPTIFKPYPLWTGKQIITTVLLNVTPPDMPGINLISKNKIKNEYWGKGSLENEVLFKDGA
LLCGILDKSQYGASKYGIVHSLHEVYGPEVAAKVLSVLGRLFTNYITATAFTCGMDDL
Structures of the domain P10964 656-833
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5w65 X-ray 4.3 A 656-833 None
5w5y X-ray 3.8 A 656-833 None
5w66 X-ray 3.9 A 656-833 None
5m5x X-ray 4 A 656-833 None
5m5y X-ray 4 A 656-833 None
5w64 X-ray 4.2 A 656-833 None
5oa1 X-ray 4.4 A 656-833 None
5m3f X-ray 3.8 A 656-833 None


© NPIDB team 2003 - 2019

text