Pfam domain
Pfam family: RNA_pol_Rpb1_5 (PF04998.16)
Uniprot AC: P10964
RecName: DNA-directed RNA polymerase I subunit RPA190
Begin-End: 989-1611
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb 

Sequence:
GIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQF
MYGGDAIDITKESHMTQFEFCLDNYYALLKKYNPSALIEHLDVESALKYSKKTLKYRKKH
SKEPHYKQSVKYDPVLAKYNPAKYLGSVSENFQDKLESFLDKNSKLFKSSDGVNEKKFRA
LMQLKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMT
ASAAIKTPQMTLPIWNDVSDEQADTFCKSISKVLLSEVIDKVIVTETTGTSNTAGGNAAR
SYVIHMRFFDNNEYSEEYDVSKEELQNVISNQFIHLLEAAIVKEIKKQKRTTGPDIGVAV
PRLQTDVANSSSNSKRLEEDNDEEQSHKKTKQAVSYDEPDEDEIETMREAEKSSDEEGID
SDKESDSDSEDEDVDMNEQINKSIVEANNNMNKVQRDRQSAIISHHRFITKYNFDDESGK
WCEFKLELAADTEKLLMVNIVEEICRKSIIRQIPHIDRCVHPEPENGKRVLVTEGVNFQA
MWDQEAFIDVDGITSNDVAAVLKTYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADM
MTRQGTYLAFNRQGMETSTSSFM
Structures of the domain P10964 989-1611
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5w65 X-ray 4.3 A 989-1610  H-Bb 
5w5y X-ray 3.8 A 989-1610  H-Bb 
5w66 X-ray 3.9 A 989-1610 None
5m5x X-ray 4 A 989-1610 None
5m5y X-ray 4 A 989-1610 None
5w64 X-ray 4.2 A 989-1610 None
5oa1 X-ray 4.4 A 989-1610 None
5m3f X-ray 3.8 A 989-1610 None


© NPIDB team 2003 - 2019

text