Pfam domain
Pfam family: RdRP_1 (PF00680.19)
Uniprot AC: P11124
RecName: RNA-directed RNA polymerase
Begin-End: 19-631
Organism: Pseudomonas phage phi6
Interaction Mode:   

Sequence:
FANNIKAQQASKRSFKEGAIETYEGLLSVDPRFLSFKNELSRYLTDHFPANVDEYGRVYG
NGVRTNFFGMRHMNGFPMIPATWPLASNLKKRADADLADGPVSERDNLLFRAAVRLMFSD
LEPVPLKIRKGSSTCIPYFSNDMGTKIEIAERALEKAEEAGNLMLQGKFDDAYQLHQMGG
AYYVVYRAQSTDAITLDPKTGKFVSKDRMVADFEYAVTGGEQGSLFAASKDASRLKEQYG
IDVPDGFFCERRRTAMGGPFALNAPIMAVAQPVRNKIYSKYAYTFHHTTRLNKEEKVKEW
SLCVATDVSDHDTFWPGWLRDLICDELLNMGYAPWWVKLFETSLKLPVYVGAPAPEQGHT
LLGDPSNPDLEVGLSSGQGATDLMGTLLMSITYLVMQLDHTAPHLNSRIKDMPSACRFLD
SYWQGHEEIRQISKSDDAILGWTKGRALVGGHRLFEMLKEGKVNPSPYMKISYEHGGAFL
GDILLYDSRREPGSAIFVGNINSMLNNQFSPEYGVQSGVRDRSKRKRPFPGLAWASMKDT
YGACPIYSDVLEAIERCWWNAFGESYRAYREDMLKRDTLELSRYVASMARQAGLAELTPI
DLEVLADPNKLQY
Structures of the domain P11124 19-631
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4a8y X-ray 3.41 C 21-630 None
4a8s X-ray 2.9 C 21-644 None
4a8w X-ray 3.04 C 21-644 None
4a8q X-ray 3.06 C 21-643 None


© NPIDB team 2003 - 2019

text