Pfam domain
Pfam family: RdRP_1 (PF00680.19)
Uniprot AC: P11124
RecName: RNA-directed RNA polymerase
Begin-End: 19-638
Organism: Pseudomonas phage phi6
Interaction Mode:   

Sequence:
FANNIKAQQASKRSFKEGAIETYEGLLSVDPRFLSFKNELSRYLTDHFPANVDEYGRVYG
NGVRTNFFGMRHMNGFPMIPATWPLASNLKKRADADLADGPVSERDNLLFRAAVRLMFSD
LEPVPLKIRKGSSTCIPYFSNDMGTKIEIAERALEKAEEAGNLMLQGKFDDAYQLHQMGG
AYYVVYRAQSTDAITLDPKTGKFVSKDRMVADFEYAVTGGEQGSLFAASKDASRLKEQYG
IDVPDGFFCERRRTAMGGPFALNAPIMAVAQPVRNKIYSKYAYTFHHTTRLNKEEKVKEW
SLCVATDVSDHDTFWPGWLRDLICDELLNMGYAPWWVKLFETSLKLPVYVGAPAPEQGHT
LLGDPSNPDLEVGLSSGQGATDLMGTLLMSITYLVMQLDHTAPHLNSRIKDMPSACRFLD
SYWQGHEEIRQISKSDDAILGWTKGRALVGGHRLFEMLKEGKVNPSPYMKISYEHGGAFL
GDILLYDSRREPGSAIFVGNINSMLNNQFSPEYGVQSGVRDRSKRKRPFPGLAWASMKDT
YGACPIYSDVLEAIERCWWNAFGESYRAYREDMLKRDTLELSRYVASMARQAGLAELTPI
DLEVLADPNKLQYKWTEADV
Structures of the domain P11124 19-638
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1hi0 X-ray 3 P 21-637 None
1hi0 X-ray 3 Q 21-637 None
1hi0 X-ray 3 R 21-637 None
1hht X-ray 2.9 P 21-637 None
1hht X-ray 2.9 Q 21-637 None
1hht X-ray 2.9 R 21-637 None
1uvm X-ray 2 A 21-637 None
1uvm X-ray 2 B 21-637 None
1uvm X-ray 2 C 21-637 None
4a8m X-ray 2.92 R 21-637 None
4a8m X-ray 2.92 Q 21-637 None
4a8m X-ray 2.92 P 21-637 None
2jlg X-ray 2.8 A 21-637 None
2jlg X-ray 2.8 B 21-637 None
2jlg X-ray 2.8 C 21-637 None
1uvi X-ray 2.15 A 21-637 None
1uvi X-ray 2.15 B 21-637 None
1uvi X-ray 2.15 C 21-637 None
4a8y X-ray 3.41 A 21-637 None
4a8y X-ray 3.41 B 21-637 None
4a8k X-ray 3.5 C 21-637 None
4a8k X-ray 3.5 B 21-637 None
4a8k X-ray 3.5 A 21-637 None
4a8f X-ray 3.3 C 21-637 None
4a8f X-ray 3.3 B 21-637 None
4a8f X-ray 3.3 A 21-637 None
4a8s X-ray 2.9 A 21-637 None
4a8s X-ray 2.9 B 21-637 None
4a8w X-ray 3.04 A 21-637 None
4a8w X-ray 3.04 B 21-637 None
4a8q X-ray 3.06 B 21-637 None
4a8q X-ray 3.06 A 21-637 None
1uvj X-ray 1.9 A 21-637 None
1uvj X-ray 1.9 B 21-637 None
1uvj X-ray 1.9 C 21-637 None
1uvl X-ray 2 A 21-637 None
1uvl X-ray 2 C 21-637 None
1uvl X-ray 2 E 21-637 None
1uvn X-ray 3 A 21-637 None
1uvn X-ray 3 C 21-637 None
1uvn X-ray 3 E 21-637 None


© NPIDB team 2003 - 2019

text