Pfam domain
Pfam family: Ets (PF00178.21)
Uniprot AC: P11308
RecName: Transcriptional regulator ERG
Begin-End: 319-398
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
QLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRY
YYDKNIMTKVHGKRYAYKFD
Structures of the domain P11308 319-398
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4iri X-ray 2.77 A 295-373  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2019

text