Pfam domain
Pfam family: Topoisom_I_N (PF02919.14)
Uniprot AC: P11387
RecName: DNA topoisomerase 1
Begin-End: 215-429
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 

Sequence:
IKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIF
RKNFFKDWRKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKL
LKEYGFCIMDNHKERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPS
PPPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIML
Structures of the domain P11387 215-429
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1seu X-ray 3 A 215-429  S-Bb S-Mj L-Bb L-Mj 
1nh3 X-ray 3.1 A 215-429 None
1tl8 X-ray 3.1 A 215-429 None
1a31 X-ray 2.1 A 215-429 None
1k4s X-ray 3.2 A 215-429 None
1k4t X-ray 2.1 A 215-429  H-Bb S-Bb S-Mj L-Bb L-Mn 
1rrj X-ray 2.3 A 215-429  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1r49 X-ray 3.13 A 215-429  S-Bb S-Mj L-Bb L-Mj L-Mn 
1ej9 X-ray 2.6 A 215-429  S-Bb S-Mj L-Bb L-Mj L-Mn 
1sc7 X-ray 3 A 215-429  S-Bb S-Mj L-Bb L-Mj L-Mn 
1lpq X-ray 3.14 A 215-429  S-Bb L-Bb L-Mj L-Mn 
1a36 X-ray 2.8 A 215-429  S-Bb S-Mj L-Bb L-Mj L-Mn 
1rr8 X-ray 2.6 C 215-429  S-Bb S-Mj L-Bb L-Mj L-Mn 
1a35 X-ray 2.5 A 215-429 None
1t8i X-ray 3 A 215-429  H-Bb S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text