Pfam domain
Pfam family: Topoisom_I (PF01028.19)
Uniprot AC: P11387
RecName: DNA topoisomerase 1
Begin-End: 432-626
Organism: Homo sapiens
Interaction Mode:   

Sequence:
SSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGN
EKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNKVPVEKRVFKNL
QLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDEN
IPAKILSYNRANRAV
Structures of the domain P11387 432-626
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1nh3 X-ray 3.1 A 432-721 None
1a31 X-ray 2.1 A 432-730 None


© NPIDB team 2003 - 2020

text