Pfam domain
Pfam family: Topoisom_I (PF01028.19)
Uniprot AC: P11387
RecName: DNA topoisomerase 1
Begin-End: 432-665
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 

Sequence:
SSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGN
EKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNKVPVEKRVFKNL
QLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDEN
IPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDAKKEQLADARRDL
Structures of the domain P11387 432-665
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1seu X-ray 3 A 432-663  H-Bb H-Mn L-Bb 
1tl8 X-ray 3.1 A 432-663  L-Bb 
1k4t X-ray 2.1 A 432-663  H-Bb H-Mn L-Bb L-Mj 
1rrj X-ray 2.3 A 432-663  H-Bb H-Mj H-Mn L-Bb L-Mj 
1r49 X-ray 3.13 A 432-670  H-Bb L-Bb L-Mj L-Mn 
1sc7 X-ray 3 A 432-663  H-Bb H-Mn L-Bb 
1lpq X-ray 3.14 A 432-670  H-Bb L-Bb L-Mj L-Mn 
1a36 X-ray 2.8 A 432-670  H-Bb H-Mn L-Bb L-Mj 
1t8i X-ray 3 A 432-663  H-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2019

text