Pfam domain
Pfam family: Topo_C_assoc (PF14370.5)
Uniprot AC: P11387
RecName: DNA topoisomerase 1
Begin-End: 695-765
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
EEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAW
AIDMADEDYEF
Structures of the domain P11387 695-765
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1seu X-ray 3 A 695-765  H-Bb 
1tl8 X-ray 3.1 A 695-765 None
1k4t X-ray 2.1 A 695-765  H-Bb 
1rrj X-ray 2.3 A 695-765  H-Bb 
1r49 X-ray 3.13 A 695-765  H-Bb L-Bb 
1sc7 X-ray 3 A 695-765  H-Bb 
1lpq X-ray 3.14 A 695-765  H-Bb L-Bb 
1a36 X-ray 2.8 A 695-765  H-Bb H-Mj L-Bb 
1t8i X-ray 3 A 695-765  H-Bb 


© NPIDB team 2003 - 2019

text