Pfam domain
Pfam family: Topo_C_assoc (PF14370.5)
Uniprot AC: P11387
RecName: DNA topoisomerase 1
Begin-End: 720-765
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF
Structures of the domain P11387 720-765
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1nh3 X-ray 3.1 A 626-765 None
1a31 X-ray 2.1 A 724-765 None


© NPIDB team 2003 - 2020

text