Pfam domain
Pfam family: Toprim (PF01751.21)
Uniprot AC: P11388
RecName: DNA topoisomerase 2-alpha
Begin-End: 456-572
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb L-Bb L-Mn 

Sequence:
TLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQIMENAEINNIIKIVG
LQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHRFLEE
Structures of the domain P11388 456-572
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4fm9 X-ray 2.9 A 457-558  H-Bb S-Bb L-Bb L-Mn 
5gwk X-ray 3.15 B 457-558 None
5gwk X-ray 3.15 A 457-558 None


© NPIDB team 2003 - 2019

text