Pfam domain
Pfam family: TOPRIM_C (PF16898.4)
Uniprot AC: P11388
RecName: DNA topoisomerase 2-alpha
Begin-End: 573-711
Organism: Homo sapiens
Interaction Mode:  H-Bb 

Sequence:
FITPIVKVSKNKQEMAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFADMK
RHRIQFKYSGPEDDAAISLAFSKKQIDDRKEWLTNFMEDRRQRKLLGLPEDYLYGQTTTY
LTYNDFINKELILFSNSDN
Structures of the domain P11388 573-711
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4fm9 X-ray 2.9 A 573-711  H-Bb 
5gwk X-ray 3.15 B 573-711 None
5gwk X-ray 3.15 A 573-711 None


© NPIDB team 2003 - 2019

text