Pfam domain
Pfam family: DNA_topoisoIV (PF00521.19)
Uniprot AC: P11388
RecName: DNA topoisomerase 2-alpha
Begin-End: 713-1172
Organism: Homo sapiens
Interaction Mode:  H-Mj S-Bb S-Mj S-Mn L-Bb 

Sequence:
RSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLA
QNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSSLARLLFPPKDDHTLKFLYDD
NQRVEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDVREIVNNIRRLMDGEEPLPMLPSY
KNFKGTIEELAPNQYVISGEVAILNSTTIEISELPVRTWTQTYKEQVLEPMLNGTEKTPP
LITDYREYHTDTTVKFVVKMTEEKLAEAERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKY
DTVLDILRDFFELRLKYYGLRKEWLLGMLGAESAKLNNQARFILEKIDGKIIIENKPKKE
LIKVLIQRGYDSDPVKAWKEAQQKVPDEEENEESDNEKETEKSDSVTDSGPTFNYLLDMP
LWYLTKEKKDELCRLRNEKEQELDTLKRKSPSDLWKEDLA
Structures of the domain P11388 713-1172
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4fm9 X-ray 2.9 A 713-1171  H-Mj S-Bb S-Mj S-Mn L-Bb 
5gwk X-ray 3.15 B 713-1171 None
5gwk X-ray 3.15 A 713-1171 None


© NPIDB team 2003 - 2019

text