Pfam domain
Pfam family: zf-C4 (PF00105.17)
Uniprot AC: P11473
RecName: Vitamin D3 receptor
Begin-End: 22-91
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb 

Sequence:
RICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKDNRRHCQACRL
KRCVDIGMMK
Structures of the domain P11473 22-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1kb6 X-ray 2.7 B 223-291  H-Bb H-Mj S-Bb L-Bb 
1kb6 X-ray 2.7 A 23-91  H-Bb H-Mj S-Bb S-Mj L-Bb 
1kb2 X-ray 2.7 B 223-291  H-Bb H-Mj S-Bb S-Mj L-Bb 
1kb2 X-ray 2.7 A 23-91  H-Bb H-Mj S-Bb S-Mj L-Bb 
1kb4 X-ray 2.8 B 223-291  H-Bb H-Mj S-Bb L-Bb 
1kb4 X-ray 2.8 A 23-91  H-Bb H-Mj S-Bb L-Bb 
1ynw X-ray 3 A 23-91  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2019

text