Pfam domain
Pfam family: Tombus_P19 (PF03220.12)
Uniprot AC: P11690
RecName: RNA silencing suppressor p19
Begin-End: 26-148
Organism: Tomato bushy stunt virus
Interaction Mode:   

Sequence:
TTSPFKLPDESPSWTEWRLHNDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHR
VLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQELL
QLA
Structures of the domain P11690 26-148
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1r9f X-ray 1.85 A 27-145 None


© NPIDB team 2003 - 2019

text