Pfam domain
Pfam family: SRF-TF (PF00319.17)
Uniprot AC: P11746
RecName: Pheromone receptor transcription factor
Begin-End: 25-72
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
FIENKTRRHVTFSKRKHGIMKKAFELSVLTGTQVLLLVVSETGLVYTF
Structures of the domain P11746 25-72
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1mnm X-ray 2.25 A 25-72  H-Bb H-Mj 
1mnm X-ray 2.25 B 25-72  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2020

text