Pfam domain
Pfam family: Rap1-DNA-bind (PF09197.12)
Uniprot AC: P11938
RecName: DNA-binding protein RAP1
Begin-End: 448-578
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
KFSADEDYTLAIAVKKQFYRDLFQIDPDTGRSLITDEDTPTAIARRNMTMDPNHVPGSEP
NFAAYRTQSRRGPIAREFFKHFAEEHAAHTENAWRDRFRKFLLAYGIDDYISYYEAEKAQ
NREPEPMKNLT
Structures of the domain P11938 448-578
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4gfb X-ray 2.99 A 448-579  H-Bb H-Mj L-Bb L-Mj 
1ign X-ray 2.25 A 448-592  H-Bb H-Mj L-Bb L-Mj 
1ign X-ray 2.25 B 448-592  H-Bb H-Mj L-Bb L-Mj 
3ukg X-ray 2.95 A 448-579  H-Bb H-Mj L-Bb L-Mj 
6ldm X-ray 2.4 A 448-573 None


© NPIDB team 2003 - 2021

text