Pfam domain
Pfam family: PCNA_C (PF02747.17)
Uniprot AC: P12004
RecName: Proliferating cell nuclear antigen
Begin-End: 127-254
Organism: Homo sapiens
Interaction Mode:  H-Bb 

Sequence:
GIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTS
NVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGH
LKYYLAPK
Structures of the domain P12004 127-254
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6tnz X-ray 4.05 E 127-254 None
6tnz X-ray 4.05 F 127-254 None
6tnz X-ray 4.05 G 127-254 None
6s1m X-ray 4.27 F 127-254 None
6s1m X-ray 4.27 E 127-254 None
6s1m X-ray 4.27 G 127-254 None
6s1n X-ray 4.86 G 127-254 None
6s1n X-ray 4.86 F 127-254  H-Bb 
6s1n X-ray 4.86 E 127-254 None
6gis X-ray 2.82 C 127-253 None
6gis X-ray 2.82 B 127-254 None
6gis X-ray 2.82 A 127-254  H-Bb 
6s1o X-ray 8.1 G 127-254 None
6s1o X-ray 8.1 E 127-254 None
6s1o X-ray 8.1 F 127-254 None
6eht X-ray 3.2 C 127-254 None
6eht X-ray 3.2 B 127-254 None
6eht X-ray 3.2 A 127-254 None
6tny X-ray 3.08 G 127-254 None
6tny X-ray 3.08 F 127-254 None
6tny X-ray 3.08 E 127-254 None


© NPIDB team 2003 - 2021

text