Pfam domain
Pfam family: Ribosomal_L36 (PF00444.17)
Uniprot AC: P12230
RecName: 50S ribosomal protein L36, chloroplastic
Begin-End: 1-37
Organism: Spinacia oleracea
Interaction Mode:   

Sequence:
MKIRASVRPICEKCRLIRRRGRIIVICSNPKHKQRQG
Structures of the domain P12230 1-37
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x8t X-ray 3.3 5 1-37 None
5h1s X-ray 3.5 f 38-74 None
5mlc X-ray 3.9 6 1-37 None
5mmi X-ray 3.25 5 1-37 None


© NPIDB team 2003 - 2019

text