Pfam domain
Pfam family: RNase_H (PF00075.26)
Uniprot AC: P12497
RecName: Gag-Pol polyprotein
Begin-End: 1023-1140
Organism: Human immunodeficiency virus type 1 group M subtype B (isolate NY5)
Interaction Mode:  H-Bb L-Bb 

Sequence:
GAETFYVDGAANRETKLGKAGYVTDRGRQKVVPLTDTTNQKTELQAIHLALQDSGLEVNI
VTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDGLVS
Structures of the domain P12497 1023-1140
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xn0 X-ray 2.6 A 436-553  L-Bb 
5xn0 X-ray 2.6 C 436-553  H-Bb L-Bb 
6kdj X-ray 2.51 A 436-553  L-Bb 
6kdj X-ray 2.51 C 436-553  L-Bb 
6kdn X-ray 2.3 C 436-553  L-Bb 
6kdn X-ray 2.3 A 436-553  L-Bb 
5xn2 X-ray 2.38 A 436-553  L-Bb 
5xn2 X-ray 2.38 C 436-553  L-Bb 
6kdm X-ray 2.32 A 436-553  L-Bb 
6kdm X-ray 2.32 C 436-553  L-Bb 
6kdo X-ray 2.57 A 436-553  L-Bb 
6kdo X-ray 2.57 C 436-553  L-Bb 
5xn1 X-ray 2.45 A 436-553  L-Bb 
5xn1 X-ray 2.45 C 436-553  L-Bb 
6kdk X-ray 2.56 A 436-553  L-Bb 
6kdk X-ray 2.56 C 436-553  L-Bb 


© NPIDB team 2003 - 2021

text