Pfam domain
Pfam family: Integrase_Zn (PF02022.21)
Uniprot AC: P12497
RecName: Gag-Pol polyprotein
Begin-End: 1155-1192
Organism: Human immunodeficiency virus type 1 group M subtype B (isolate NY5)
Interaction Mode:   

Sequence:
AQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQL
Structures of the domain P12497 1155-1192
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6v3k X-ray 3.4 A 8-45 None
6v3k X-ray 3.4 B 8-58 None
5u1c X-ray 3.9 C 8-45 None
5u1c X-ray 3.9 A 8-45 None
6put X-ray 2.9 A 8-45 None
6put X-ray 2.9 B 8-57 None
6vdk X-ray 4.5 D 8-45 None
6vdk X-ray 4.5 C 8-45 None
6vdk X-ray 4.5 B 8-45 None
6vdk X-ray 4.5 A 8-45 None
6puw X-ray 2.9 A 8-45 None
6puw X-ray 2.9 B 8-57 None
6puy X-ray 2.8 A 8-45 None
6puy X-ray 2.8 B 8-58 None
6puz X-ray 2.8 B 8-57 None
6puz X-ray 2.8 A 8-45 None
6u8q X-ray 4.67 D 8-45 None
6u8q X-ray 4.67 C 8-45 None
6u8q X-ray 4.67 B 8-45 None
6u8q X-ray 4.67 A 8-45 None


© NPIDB team 2003 - 2021

text