Pfam domain
Pfam family: rve (PF00665.25)
Uniprot AC: P12497
RecName: Gag-Pol polyprotein
Begin-End: 1203-1281
Organism: Human immunodeficiency virus type 1 group M subtype B (isolate NY5)
Interaction Mode:   

Sequence:
CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHT
DNGSNFTSTTVKAACWWAG
Structures of the domain P12497 1203-1281
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5u1c X-ray 3.9 B 59-153 None
5u1c X-ray 3.9 D 59-153 None


© NPIDB team 2003 - 2021

text