Pfam domain
Pfam family: IN_DBD_C (PF00552.23)
Uniprot AC: P12497
RecName: Gag-Pol polyprotein
Begin-End: 1372-1415
Organism: Human immunodeficiency virus type 1 group M subtype B (isolate NY5)
Interaction Mode:   

Sequence:
VYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKII
Structures of the domain P12497 1372-1415
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6v3k X-ray 3.4 D 225-268  H-Bb 
6v3k X-ray 3.4 C 225-268  L-Bb 
6v3k X-ray 3.4 B 225-268  H-Bb 
6v3k X-ray 3.4 A 221-268 None
5u1c X-ray 3.9 C 225-268  H-Bb S-Bb 
5u1c X-ray 3.9 B 225-268  S-Bb L-Bb 
5u1c X-ray 3.9 A 225-268  H-Bb S-Bb 
5u1c X-ray 3.9 D 225-268  S-Bb L-Bb 
6put X-ray 2.9 D 225-268  S-Bb L-Bb 
6put X-ray 2.9 B 226-267 None
6put X-ray 2.9 C 225-268  L-Bb 
6vdk X-ray 4.5 M 225-268  S-Bb L-Bb 
6vdk X-ray 4.5 P 225-268  S-Bb L-Bb 
6vdk X-ray 4.5 J 225-268  L-Bb L-Mj 
6vdk X-ray 4.5 D 225-268 None
6vdk X-ray 4.5 I 225-268  L-Bb 
6vdk X-ray 4.5 C 225-268 None
6vdk X-ray 4.5 B 225-268 None
6vdk X-ray 4.5 A 225-268 None
6puw X-ray 2.9 A 220-268 None
6puw X-ray 2.9 D 225-268  S-Bb L-Bb 
6puw X-ray 2.9 C 225-268  S-Bb 
6puy X-ray 2.8 D 225-268  L-Bb 
6puy X-ray 2.8 A 219-268 None
6puy X-ray 2.8 B 225-268 None
6puy X-ray 2.8 C 225-268  L-Bb 
6puz X-ray 2.8 D 225-268  S-Bb L-Bb 
6puz X-ray 2.8 C 225-268  L-Bb 
6puz X-ray 2.8 B 225-268  H-Bb 
6puz X-ray 2.8 A 219-268 None
6u8q X-ray 4.67 P 225-268  H-Bb S-Bb L-Bb 
6u8q X-ray 4.67 M 225-268  S-Bb L-Bb 
6u8q X-ray 4.67 J 225-268  L-Bb 
6u8q X-ray 4.67 I 225-268  S-Bb L-Bb 
6u8q X-ray 4.67 D 225-268 None
6u8q X-ray 4.67 C 225-268 None
6u8q X-ray 4.67 B 225-268 None
6u8q X-ray 4.67 A 225-268 None


© NPIDB team 2003 - 2021

text