Pfam domain
Pfam family: RVT_1 (PF00078.29)
Uniprot AC: P12497
RecName: Gag-Pol polyprotein
Begin-End: 650-821
Organism: Human immunodeficiency virus type 1 group M subtype B (isolate NY5)
Interaction Mode:   

Sequence:
IKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPLDK
DFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVIYQ
YMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYEL
Structures of the domain P12497 650-821
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xn0 X-ray 2.6 A 63-234 None
5xn0 X-ray 2.6 B 63-260 None
5xn0 X-ray 2.6 C 63-234 None
5xn0 X-ray 2.6 D 63-260 None
6kdj X-ray 2.51 B 63-260 None
6kdj X-ray 2.51 A 63-234 None
6kdj X-ray 2.51 C 63-234 None
6kdj X-ray 2.51 D 63-260 None
6kdn X-ray 2.3 C 63-234 None
6kdn X-ray 2.3 D 63-260 None
6kdn X-ray 2.3 B 63-260 None
6kdn X-ray 2.3 A 63-234 None
6ika X-ray 2.6 B 63-260 None
6ika X-ray 2.6 D 63-260 None
5xn2 X-ray 2.38 B 63-260 None
5xn2 X-ray 2.38 A 63-234 None
5xn2 X-ray 2.38 D 63-260 None
5xn2 X-ray 2.38 C 63-234 None
6kdm X-ray 2.32 A 63-234 None
6kdm X-ray 2.32 B 63-260 None
6kdm X-ray 2.32 C 63-234 None
6kdm X-ray 2.32 D 63-260 None
6kdo X-ray 2.57 B 63-260 None
6kdo X-ray 2.57 A 63-234 None
6kdo X-ray 2.57 D 63-260 None
6kdo X-ray 2.57 C 63-234 None
5xn1 X-ray 2.45 B 63-260 None
5xn1 X-ray 2.45 A 63-234 None
5xn1 X-ray 2.45 D 63-260 None
5xn1 X-ray 2.45 C 63-234 None
6kdk X-ray 2.56 A 63-234 None
6kdk X-ray 2.56 B 63-260 None
6kdk X-ray 2.56 C 63-234 None
6kdk X-ray 2.56 D 63-260 None
6ik9 X-ray 2.44 B 63-260 None
6ik9 X-ray 2.44 D 63-260 None


© NPIDB team 2003 - 2021

text