Pfam domain
Pfam family: RVT_thumb (PF06817.16)
Uniprot AC: P12497
RecName: Gag-Pol polyprotein
Begin-End: 828-891
Organism: Human immunodeficiency virus type 1 group M subtype B (isolate NY5)
Interaction Mode:  H-Bb H-Mn L-Bb L-Mn 

Sequence:
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTEEAE
LELA
Structures of the domain P12497 828-891
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xn0 X-ray 2.6 B 241-304 None
5xn0 X-ray 2.6 A 241-304  L-Bb 
5xn0 X-ray 2.6 C 241-304  H-Bb L-Bb 
5xn0 X-ray 2.6 D 241-304 None
6kdj X-ray 2.51 B 241-304 None
6kdj X-ray 2.51 A 241-304  L-Bb 
6kdj X-ray 2.51 D 241-304 None
6kdj X-ray 2.51 C 241-304  H-Bb L-Bb 
6kdn X-ray 2.3 D 241-304 None
6kdn X-ray 2.3 C 241-304  H-Bb L-Bb 
6kdn X-ray 2.3 B 241-304 None
6kdn X-ray 2.3 A 241-304  H-Bb L-Bb 
6ika X-ray 2.6 B 241-304 None
6ika X-ray 2.6 D 241-304 None
5xn2 X-ray 2.38 B 241-304 None
5xn2 X-ray 2.38 A 241-304  H-Bb L-Bb 
5xn2 X-ray 2.38 D 241-304 None
5xn2 X-ray 2.38 C 241-304  L-Bb 
6kdm X-ray 2.32 B 241-304 None
6kdm X-ray 2.32 A 241-304  H-Bb L-Bb 
6kdm X-ray 2.32 D 241-304 None
6kdm X-ray 2.32 C 241-304  H-Bb L-Bb L-Mn 
6kdo X-ray 2.57 B 241-304 None
6kdo X-ray 2.57 A 241-304  H-Bb H-Mn L-Bb 
6kdo X-ray 2.57 D 241-304 None
6kdo X-ray 2.57 C 241-304  L-Bb 
5xn1 X-ray 2.45 B 241-304 None
5xn1 X-ray 2.45 A 241-304  L-Bb 
5xn1 X-ray 2.45 D 241-304 None
5xn1 X-ray 2.45 C 241-304  L-Bb 
6kdk X-ray 2.56 B 241-304 None
6kdk X-ray 2.56 A 241-304  L-Bb 
6kdk X-ray 2.56 D 241-304 None
6kdk X-ray 2.56 C 241-304  L-Bb 
6ik9 X-ray 2.44 B 241-304 None
6ik9 X-ray 2.44 D 241-304 None


© NPIDB team 2003 - 2021

text