Pfam domain
Pfam family: Ribosomal_L5 (PF00281.18)
Uniprot AC: P12877
RecName: 50S ribosomal protein L5
Begin-End: 24-80
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
SVMQVPKIEKIVINMGVGDAVQNAKAIDSAVEELTFIAGQKPVVTRAKKSIAGFRLR
Structures of the domain P12877 24-80
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j3v X-ray 13.3 F 24-80 None


© NPIDB team 2003 - 2019

text