Pfam domain
Pfam family: Ku (PF02735.15)
Uniprot AC: P12956
RecName: X-ray repair cross-complementing protein 6
Begin-End: 263-464
Organism: Homo sapiens
Interaction Mode:  L-Bb 

Sequence:
LNKDIVISVGIYNLVQKALKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQIY
GSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLKKHHYLRPSLFVYPEESLVIGSSTLF
SALLIKCLEKEVAALCRYTPRRNIPPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADD
KRKMPFTEKIMATPEQVGKMKA
Structures of the domain P12956 263-464
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1jey X-ray 2.5 A 265-451  L-Bb 
5y3r X-ray 6.6 A 265-451 None


© NPIDB team 2003 - 2019

text