Pfam domain
Pfam family: Ku_C (PF03730.13)
Uniprot AC: P12956
RecName: X-ray repair cross-complementing protein 6
Begin-End: 472-534
Organism: Homo sapiens
Interaction Mode:   

Sequence:
TYRSDSFENPVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYP
PDY
Structures of the domain P12956 472-534
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1jey X-ray 2.5 A 473-534 None
5y3r X-ray 6.6 A 473-534 None


© NPIDB team 2003 - 2019

text