Pfam domain
Pfam family: Ku (PF02735.15)
Uniprot AC: P13010
RecName: X-ray repair cross-complementing protein 5
Begin-End: 253-453
Organism: Homo sapiens
Interaction Mode:  S-Bb L-Bb L-Mn 

Sequence:
IGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQ
GFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEA
AAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQ
YMFSSLKNSKKYAPTEAQLNA
Structures of the domain P13010 253-453
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1jey X-ray 2.5 B 253-452  S-Bb L-Bb L-Mn 
5y3r X-ray 6.6 B 253-452 None


© NPIDB team 2003 - 2019

text