Pfam domain
Pfam family: Ku_C (PF03730.13)
Uniprot AC: P13010
RecName: X-ray repair cross-complementing protein 5
Begin-End: 476-545
Organism: Homo sapiens
Interaction Mode:  H-Bb 

Sequence:
LFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKT
LFPLIEAKKK
Structures of the domain P13010 476-545
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1jey X-ray 2.5 B 477-543  H-Bb 
5y3r X-ray 6.6 B 477-539 None


© NPIDB team 2003 - 2019

text