Pfam domain
Pfam family: UDG (PF03167.21)
Uniprot AC: P13051
RecName: Uracil-DNA glycosylase
Begin-End: 140-302
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mn L-Bb L-Mj L-Mn 

Sequence:
MCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHG
DLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQ
KKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQK
Structures of the domain P13051 140-302
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4skn X-ray 2.9 E 132-293 None
1ssp X-ray 1.9 E 132-293  H-Bb H-Mn L-Bb L-Mj L-Mn 
1emh X-ray 1.8 A 132-293  H-Bb L-Bb L-Mj L-Mn 
2ssp X-ray 2.25 E 132-293  H-Bb H-Mn L-Bb L-Mj L-Mn 
1emj X-ray 2 A 132-293  H-Bb L-Bb L-Mj L-Mn 
2oyt X-ray 2 A 132-293  H-Bb H-Mn L-Bb L-Mj L-Mn 
1q3f X-ray 1.9 A 132-293  H-Bb H-Mn L-Bb L-Mj L-Mn 
2oxm X-ray 2.5 A 132-293  H-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text