Pfam domain
Pfam family: UDG (PF03167.18)
Uniprot AC: P13051
RecName: Uracil-DNA glycosylase
Begin-End: 140-302
Organism: Homo sapiens
Interaction Mode:   

Sequence:
MCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHG
DLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQ
KKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQK
Structures of the domain P13051 140-302
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4skn X-ray 2.9 E 135-290 None
1ssp X-ray 1.9 E 135-290 None
1emh X-ray 1.8 A 135-290 None
2ssp X-ray 2.25 E 135-290 None
1emj X-ray 2 A 135-290 None
2oyt X-ray 2 A 135-290 None
1q3f X-ray 1.9 A 135-290 None
2oxm X-ray 2.5 A 135-290 None


© NPIDB team 2003 - 2019

text