Pfam domain
Pfam family: 7kD_DNA_binding (PF02294.17)
Uniprot AC: P13123
RecName: DNA-binding protein 7d
Begin-End: 3-60
Organism: Sulfolobus acidocaldarius
Interaction Mode:   

Sequence:
KVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLAR
Structures of the domain P13123 3-60
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1wtr X-ray 1.8 A 3-60 None
1azp X-ray 1.6 A 3-60 None
1azq X-ray 1.94 A 3-60 None
1wto X-ray 1.5 A 3-60 None
1wtx X-ray 2.2 A 3-60 None
1wvl X-ray 2.6 B 3-60 None
1wvl X-ray 2.6 A 3-60 None
1wtv X-ray 1.6 A 3-60 None
1xyi X-ray 1.45 A 3-60 None
1wtq X-ray 1.7 A 3-60 None
1wtw X-ray 2.2 A 3-60 None
1wd1 X-ray 2.2 A 3-60 None
1wtp X-ray 1.9 B 3-60 None
1wtp X-ray 1.9 A 3-60 None
1wd0 X-ray 1.9 A 3-60 None
1bf4 X-ray 1.6 A 3-61 None
1ca5 X-ray 2.2 A 3-60 None
1ca6 X-ray 2.2 A 3-60 None


© NPIDB team 2003 - 2019

text