Pfam domain
Pfam family: 5_3_exonuc_N (PF02739.15)
Uniprot AC: P13319
RecName: Ribonuclease H
Begin-End: 17-188
Organism: Enterobacteria phage T4
Interaction Mode:  H-Bb L-Bb L-Mn 

Sequence:
LIDFSQIALSTALVNFPDKEKINLSMVRHLILNSIKFNVKKAKTLGYTKIVLCIDNAKSG
YWRRDFAYYYKKNRGKAREESTWDWEGYFESSHKVIDELKAYMPYIVMDIDKYEADDHIA
VLVKKFSLEGHKILIISSDGDFTQLHKYPNVKQWSPMHKKWVKIKSGSAEID
Structures of the domain P13319 17-188
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ihn X-ray 3 A 54-174  H-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2019

text