Pfam domain
Pfam family: DNA_pol_B_exo1 (PF03104.18)
Uniprot AC: P13382
RecName: DNA polymerase alpha catalytic subunit A
Begin-End: 375-719
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KDDNCVSAMVQINGLCRELFFLPREGKTPTDIHEEIIPLLMDKYGLDNIRAKPQKMKYSF
ELPDIPSESDYLKVLLPYQTPKSSRDTIPSDLSSDTFYHVFGGNSNIFESFVIQNRIMGP
CWLDIKGADFNSIRNASHCAVEVSVDKPQNITPTTTKTMPNLRCLSLSIQTLMNPKENKQ
EIVSITLSAYRNISLDSPIPENIKPDDLCTLVRPPQSTSFPLGLAALAKQKLPGRVRLFN
NEKAMLSCFCAMLKVEDPDVIIGHRLQNVYLDVLAHRMHDLNIPTFSSIGRRLRRTWPEK
FGRGNSNMNHFFISDICSGRLICDIANEMGQSLTPKCQSWDLSEM
Structures of the domain P13382 375-719
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4fxd X-ray 3 A 376-719 None
4fxd X-ray 3 B 376-719 None
4fyd X-ray 3.1 B 376-719 None
4fyd X-ray 3.1 A 376-719 None


© NPIDB team 2003 - 2020

text