Pfam domain
Pfam family: DNA_pol_B (PF00136.20)
Uniprot AC: P13382
RecName: DNA polymerase alpha catalytic subunit A
Begin-End: 783-1229
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb S-Bb L-Bb L-Mn 

Sequence:
NAWAQTLGGTRAGRNEYILLHEFSRNGFIVPDKEGNRSRAQKQRQNEENADAPVNSKKAK
YQGGLVFEPEKGLHKNYVLVMDFNSLYPSIIQEFNICFTTVDRNKEDIDELPSVPPSEVD
QGVLPRLLANLVDRRREVKKVMKTETDPHKRVQCDIRQQALKLTANSMYGCLGYVNSRFY
AKPLAMLVTNKGREILMNTRQLAESMNLLVVYGDTDSVMIDTGCDNYADAIKIGLGFKRL
VNERYRLLEIDIDNVFKKLLLHAKKKYAALTVNLDKNGNGTTVLEVKGLDMKRREFCPLS
RDVSIHVLNTILSDKDPEEALQEVYDYLEDIRIKVETNNIRIDKYKINMKLSKDPKAYPG
GKNMPAVQVALRMRKAGRVVKAGSVITFVITKQDEIDNAADTPALSVAERAHALNEVMIK
SNNLIPDPQYYLEKQIFAPVERLLERI
Structures of the domain P13382 783-1229
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4fxd X-ray 3 A 778-1229 None
4fxd X-ray 3 B 778-1132 None
4fyd X-ray 3.1 B 778-1229  H-Bb S-Bb L-Bb L-Mn 
4fyd X-ray 3.1 A 778-1229 None


© NPIDB team 2003 - 2019

text