Pfam domain
Pfam family: TBP (PF00352.20)
Uniprot AC: P13393
RecName: TATA-box-binding protein
Begin-End: 154-237
Organism: Saccharomyces cerevisiae
Interaction Mode:  S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 

Sequence:
DFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIV
LTGAKQREEIYQAFEAIYPVLSEF
Structures of the domain P13393 154-237
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6f41 X-ray 4.3 U 154-237 None
1ytf X-ray 2.5 A 154-237  S-Bb S-Mn L-Bb L-Mj L-Mn 
1ngm X-ray 2.95 I 154-237  S-Bb S-Mn L-Bb L-Mj L-Mn 
1ngm X-ray 2.95 M 154-237 None
1ngm X-ray 2.95 E 154-237 None
1ngm X-ray 2.95 A 154-237 None
1rm1 X-ray 2.5 A 154-237  S-Bb S-Mj S-Mn L-Bb 
1nh2 X-ray 1.9 A 154-237 None
1ytb X-ray 1.8 A 154-237  S-Bb S-Mn L-Bb L-Mj L-Mn 
1ytb X-ray 1.8 B 154-237  S-Bb S-Mn L-Bb L-Mj L-Mn 
6f44 X-ray 4.2 U 154-237 None
5fmf X-ray 6 Q 154-237 None
6eu0 X-ray 4 Y 154-237  S-Bb S-Mn L-Bb L-Mn 
4v1o X-ray 9.7 O 154-237  S-Bb S-Mn L-Bb L-Mj L-Mn 
6f40 X-ray 3.7 U 154-237  S-Bb S-Mn L-Bb L-Mj L-Mn 
5oqj X-ray 4.7 O 154-237  L-Bb 
6f42 X-ray 5.5 U 154-237 None
5sva X-ray 15.3 j 154-237 None
5fyw X-ray 4.35 O 154-237  S-Bb S-Mn L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2020

text