Pfam domain
Pfam family: TBP (PF00352.20)
Uniprot AC: P13393
RecName: TATA-box-binding protein
Begin-End: 64-146
Organism: Saccharomyces cerevisiae
Interaction Mode:  S-Bb S-Mn L-Bb L-Mn 

Sequence:
VPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVV
TGAKSEDDSKLASRKYARIIQKI
Structures of the domain P13393 64-146
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6f41 X-ray 4.3 U 66-146 None
1ytf X-ray 2.5 A 66-146  S-Bb S-Mn L-Bb L-Mn 
1ngm X-ray 2.95 I 66-146  S-Bb S-Mn L-Bb 
1ngm X-ray 2.95 M 66-146 None
1ngm X-ray 2.95 E 66-146 None
1ngm X-ray 2.95 A 66-146 None
1rm1 X-ray 2.5 A 66-146  S-Bb S-Mn L-Bb L-Mn 
1nh2 X-ray 1.9 A 66-146 None
1ytb X-ray 1.8 A 66-146  S-Bb S-Mn L-Bb L-Mn 
1ytb X-ray 1.8 B 66-146  S-Bb S-Mn L-Bb L-Mn 
6f44 X-ray 4.2 U 66-146 None
5fmf X-ray 6 Q 66-146 None
6eu0 X-ray 4 Y 66-146  S-Mn 
4v1o X-ray 9.7 O 66-146  S-Bb S-Mn L-Bb L-Mn 
6f40 X-ray 3.7 U 66-146  S-Bb S-Mn L-Bb L-Mn 
5oqj X-ray 4.7 O 66-146 None
6f42 X-ray 5.5 U 66-146 None
5sva X-ray 15.3 j 6-146 None
5fyw X-ray 4.35 O 66-146  S-Bb S-Mn L-Bb L-Mn 


© NPIDB team 2003 - 2020

text