Pfam domain
Pfam family: TBP (PF00352.23)
Uniprot AC: P13393
RecName: TATA-box-binding protein
Begin-End: 64-146
Organism: Saccharomyces cerevisiae
Interaction Mode:  S-Bb S-Mn L-Bb L-Mj L-Mn 

Sequence:
VPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVV
TGAKSEDDSKLASRKYARIIQKI
Structures of the domain P13393 64-146
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ytf X-ray 2.5 A 64-146  S-Bb S-Mn L-Bb L-Mn 
1ngm X-ray 2.95 M 64-146  S-Bb S-Mn L-Bb L-Mn 
1ngm X-ray 2.95 E 64-146  S-Bb S-Mn L-Bb L-Mn 
1ngm X-ray 2.95 I 64-146  S-Bb S-Mn L-Bb 
1ngm X-ray 2.95 A 64-146  S-Bb S-Mn L-Bb L-Mn 
1rm1 X-ray 2.5 A 64-146  S-Bb S-Mn L-Bb L-Mj L-Mn 
1nh2 X-ray 1.9 A 64-146  S-Bb S-Mn L-Bb L-Mn 
1ytb X-ray 1.8 B 64-146  S-Bb S-Mn L-Bb L-Mn 
1ytb X-ray 1.8 A 64-146  S-Bb S-Mn L-Bb L-Mn 
6eu0 X-ray 4 Y 64-146  S-Mn L-Bb L-Mn 
5fmf X-ray 6 Q 64-146  S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 
4v1o X-ray 9.7 O 64-146  S-Bb S-Mn L-Bb L-Mn 
5fyw X-ray 4.35 O 64-146  S-Bb S-Mn L-Bb L-Mn 
4v1n X-ray 7.8 O 64-146  S-Bb S-Mn L-Bb L-Mn 
6gyk X-ray 5.1 O 64-146  S-Bb S-Mn L-Bb 
6cnc X-ray 4.1 R 390-472  S-Bb S-Mn L-Bb 
6f44 X-ray 4.2 U 64-146  S-Bb S-Mn L-Bb 
6f41 X-ray 4.3 U 64-146  S-Bb S-Mn L-Bb L-Mn 
5oqj X-ray 4.7 O 64-146  S-Bb S-Mn L-Bb L-Mn 
5fz5 X-ray 8.8 O 64-146  S-Bb S-Mn L-Bb L-Mn 
5oqm X-ray 5.8 O 64-146 None
6cnf X-ray 4.5 R 390-472  S-Bb S-Mn L-Bb 
6gym X-ray 6.7 O 64-146  S-Mj S-Mn L-Bb 
6gyl X-ray 4.8 O 64-146  S-Bb L-Bb 
5sva X-ray 15.3 j 64-146  S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 
6f40 X-ray 3.7 U 64-146  S-Bb S-Mn L-Bb L-Mn 
6cnb X-ray 4.1 R 390-472  S-Bb S-Mn L-Bb L-Mn 
6f42 X-ray 5.5 U 64-146  S-Bb S-Mn L-Bb L-Mn 
6cnd X-ray 4.8 R 390-472  S-Bb S-Mj S-Mn L-Bb L-Mn 


© NPIDB team 2003 - 2021

text