Pfam domain
Pfam family: Sigma70_r4 (PF04545.15)
Uniprot AC: P13445
RecName: RNA polymerase sigma factor RpoS
Begin-End: 262-315
Organism: Escherichia coli
Interaction Mode:   

Sequence:
WLFELNAKQREVLARRFGLLGYEAATLEDVGREIGLTRERVRQIQVEGLRRLRE
Structures of the domain P13445 262-315
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ipn X-ray 4.61 F 262-315 None
5ipl X-ray 3.6 F 262-315 None
5ipm X-ray 4.2 F 262-315 None


© NPIDB team 2003 - 2019

text