Pfam domain
Pfam family: Sigma70_r1_2 (PF00140.19)
Uniprot AC: P13445
RecName: RNA polymerase sigma factor RpoS
Begin-End: 56-89
Organism: Escherichia coli
Interaction Mode:   

Sequence:
DATQLYLGEIGYSPLLTAEEEVYFARRALRGDVA
Structures of the domain P13445 56-89
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ipn X-ray 4.61 F 56-88 None
5ipl X-ray 3.6 F 56-88 None
5ipm X-ray 4.2 F 56-88 None


© NPIDB team 2003 - 2019

text