Pfam domain
Pfam family: Ribosomal_S4 (PF00163.18)
Uniprot AC: P13788
RecName: 30S ribosomal protein S4, chloroplastic
Begin-End: 3-88
Organism: Spinacia oleracea
Interaction Mode:   

Sequence:
RYRGPRFKKIRRLGALPGLTNKRPRAGSDLRNQSRSGKRSQYRIRLEEKQKLRFHYGITE
RQLLKYVRIARKAKGSTGQVLLQLLE
Structures of the domain P13788 3-88
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5mmj X-ray 3.65 d 3-88 None
5x8r X-ray 3.7 d 3-88 None


© NPIDB team 2003 - 2019

text