Pfam domain
Pfam family: DNA_methylase (PF00145.19)
Uniprot AC: P13864
RecName: DNA (cytosine-5)-methyltransferase 1
Begin-End: 1142-1596
Organism: Mus musculus
Interaction Mode:   

Sequence:
LRTLDVFSGCGGLSEGFHQAGISETLWAIEMWDPAAQAFRLNNPGTTVFTEDCNVLLKLV
MAGEVTNSLGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDYY
RPRFFLLENVRNFVSYRRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAA
APGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEIQ
NGASNSEIPYNGEPLSWFQRQLRGSHYQPILRDHICKDMSPLVAARMRHIPLFPGSDWRD
LPNIQVRLGDGVIAHKLQYTFHDVKNGYSSTGALRGVCSCAEGKACDPESRQFSTLIPWC
LPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGF
PDSYRFFGNILDRHRQVGNAVPPPLAKAIGLEIKL
Structures of the domain P13864 1142-1596
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6w8v X-ray 3.12 B 1142-1596  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
6w8v X-ray 3.12 A 1142-1596  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
4da4 X-ray 2.6 A 1142-1596 None
4da4 X-ray 2.6 B 1142-1596 None
6w8w X-ray 3 B 1142-1596  H-Bb H-Mj L-Bb L-Mj 
6w8w X-ray 3 A 1142-1596  H-Bb H-Mj L-Bb L-Mj L-Mn 
3pt6 X-ray 3 A 1142-1596  H-Bb L-Bb 
3pt6 X-ray 3 B 1142-1596  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text