Pfam domain
Pfam family: zf-CXXC (PF02008.22)
Uniprot AC: P13864
RecName: DNA (cytosine-5)-methyltransferase 1
Begin-End: 651-694
Organism: Mus musculus
Interaction Mode:   

Sequence:
MKRRRCGVCEVCQQPECGKCKACKDMVKFGGTGRSKQACLKRRC
Structures of the domain P13864 651-694
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3pt6 X-ray 3 A 651-694  L-Bb L-Mj 
3pt6 X-ray 3 B 650-694  L-Bb L-Mj 


© NPIDB team 2003 - 2021

text