Pfam domain
Pfam family: BAH (PF01426.20)
Uniprot AC: P13864
RecName: DNA (cytosine-5)-methyltransferase 1
Begin-End: 935-1103
Organism: Mus musculus
Interaction Mode:   

Sequence:
VVYRLGDSVYLPPEAFTFNIKVASPVKRPKKDPVNETLYPEHYRKYSDYIKGSNLDAPEP
YRIGRIKEIHCGKKKGKVNEADIKLRLYKFYRPENTHRSYNGSYHTDINMLYWSDEEAVV
NFSDVQGRCTVEYGEDLLESIQDYSQGGPDRFYFLEAYNSKTKNFEDPP
Structures of the domain P13864 935-1103
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6w8v X-ray 3.12 B 935-1103  L-Bb L-Mj 
6w8v X-ray 3.12 A 935-1103  L-Bb L-Mj 
4da4 X-ray 2.6 A 935-1103 None
4da4 X-ray 2.6 B 935-1103 None
6w8w X-ray 3 A 935-1103 None
6w8w X-ray 3 B 935-1103 None
3pt6 X-ray 3 A 935-1103 None
3pt6 X-ray 3 B 935-1103 None


© NPIDB team 2003 - 2021

text