Pfam domain
Pfam family: PemK_toxin (PF02452.16)
Uniprot AC: P13976
RecName: Endoribonuclease PemK
Begin-End: 25-132
Organism: Escherichia coli
Interaction Mode:   

Sequence:
ERGEIWLVSLDPTAGHEQQGTRPVLIVTPAAFNRVTRLPVVVPVTSGGNFARTAGFAVSL
DGVGIRTTGVVRCDQPRTIDMKARGGKRLERVPETIMNEVLGRLSTIL
Structures of the domain P13976 25-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2c06 NMR A 2-108 None
2c06 NMR B 2-108 None


© NPIDB team 2003 - 2019

text