Pfam domain
Pfam family: TFIIF_beta (PF02270.14)
Uniprot AC: P13984
RecName: General transcription factor IIF subunit 2
Begin-End: 176-238
Organism: Homo sapiens
Interaction Mode:  H-Bb L-Bb L-Mn 

Sequence:
ARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWEL
KPE
Structures of the domain P13984 176-238
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 T 99-238  H-Bb L-Bb L-Mn 
5iya X-ray 5.4 T 99-238  H-Bb L-Bb L-Mn 
5iy8 X-ray 7.9 T 99-238  H-Bb L-Bb L-Mn 
5iyd X-ray 3.9 T 99-238  L-Bb L-Mn 
5iy6 X-ray 7.2 T 99-238  H-Bb L-Bb L-Mn 
5iyc X-ray 3.9 T 99-238  H-Bb L-Bb L-Mn 
5iy9 X-ray 6.3 T 99-238  L-Bb L-Mn 
5iyb X-ray 3.9 T 99-238  H-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2019

text