Pfam domain
Pfam family: rve (PF00665.28)
Uniprot AC: P14078
RecName: Gag-Pro-Pol polyprotein
Begin-End: 1222-1316
Organism: Human T-cell leukemia virus 1 (isolate Caribbea HS-35 subtype A)
Interaction Mode:   

Sequence:
LPNHIWQGDITHFKYKNTLYRLHVWVDTFSGAISATQKRKETSSEAISSLLQAIAYLGKP
SYINTDNGPAYISQDFLNMCTSLAIRHTTHVPYNP
Structures of the domain P14078 1222-1316
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6voy X-ray 3.7 A 55-149  H-Bb H-Mn L-Bb L-Mj 
6voy X-ray 3.7 D 55-149 None
6voy X-ray 3.7 B 55-149 None
6voy X-ray 3.7 C 55-149  H-Bb H-Mn L-Bb 


© NPIDB team 2003 - 2021

text