Pfam domain
Pfam family: IN_DBD_C (PF00552.23)
Uniprot AC: P14078
RecName: Gag-Pro-Pol polyprotein
Begin-End: 1397-1441
Organism: Human T-cell leukemia virus 1 (isolate Caribbea HS-35 subtype A)
Interaction Mode:   

Sequence:
FKLPGLNSRQWKGPQEALQEAAGAALIPVSASSAQWIPWRLLKRA
Structures of the domain P14078 1397-1441
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6voy X-ray 3.7 B 230-274  L-Bb 
6voy X-ray 3.7 D 230-274  L-Bb 
6voy X-ray 3.7 C 230-274 None
6voy X-ray 3.7 A 230-274 None


© NPIDB team 2003 - 2021

text